PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN...

PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN...

Shared by: Gaige Batten from AMAZON
Share
  • Reference Price:
    515.00
  • Average Customer Review:
    Be the first to review this item
  • ASIN:
    B00XAN0IME
  • Shipping Information:
    View shipping rates and policies
Over 163 suppliers can give you a quotation.
Get Quotations Now
You should get the quotation(s) in 5 hours .
Description

SynName: Anti -PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN-34, BCAP); PHF11 (PHD Finger Protein 11, BRCA1 C-terminus-associated Protein, Renal Carcinoma Antigen NY-REN-34, BCAP); *Specificity: Recognizes human PHF11.Immunogen: Full length recombinant corresponding to aa1-293 from human PHF11 (AAH17212) with GST tag. MW of the GST tag alone is 26kD.; *Seq: MEKRTCALCPKDVEYNVLYFAQSENIAAHENCLLYSSGLVECEDQDPLNPDRSFDVESVKKEIQRGRKLKCKFCHKRGATVGCDLKNCNKNYHFFCAKKDDAVPQSDGVRGIYKLLCQQHAQFPIIAQSAKFSGVKRKRGRKKPLSGNHVQPPETMKCNTFIRQVKEEHGRHTDATVKVPFLKKCKEAGLLNYLLEEILDKVHSIPEKLMDETTSESDYEEIGSALFDCRLFEDTFVNFQAAIEKKIHASQQRWQQLKEEIELLQDLKQTLCSFQENRDLMSSSTSISSLSY; *Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.; *Accession#: NP_001035534.1; NM_001040444.1; Q9UIL8; *Description: Positive regulator of Th1-type cytokine gene expression.; *Uniprot Summary: Function: Positive regulator of Th1-type cytokine gene expression. Ref.8Subunit structure: Interacts with BRCA1 and RELA. Ref.8Subcellular location: Nucleus Ref.8. Tissue specificity: Highly expressed in T and B-cells, as well as natural killer and mature dendritic cells. Expressed at higher levels in Th1 as compared to Th2 cells. Expressed at low levels in all normal tissues tested, including lung, testis, small intestine, breast, liver and placenta. Ref.8Polymorphism: Variation in PHF11 seems to be associated with propensity to childhood atopic dermatitis and asthma.Sequence similarities: Contains 1 PHD-type zinc finger.Sequence caution: The sequence AAD42871.1 differs from that shown. Reason: Frameshift at positions 226 and 253. The sequence AAH17212.2 differs from that shown. Reason: Erroneous initiation.

Notice:The articles, pictures, news, opinions, videos, or information posted on this webpage (excluding all intellectual properties owned by Alibaba Group in this webpage) are uploaded by registered members of Alibaba. If you are suspect of any unauthorized use of your intellectual property rights on this webpage, please report it to us at the following:ali-guide@service.alibaba.com.

aisn-detail011000230170