6:03 Zhucheng Haotian Pharm ZCHT) - Global Leading Supplier of Stevia, Inositol and PQQ. 
Only Natural 525873 Pure Inositol Powder 4 Oz $34.63
Only Naturals Pure Inositol Powder is an inositol supplement that is used to reinforce a diet. Inositol supplements may contribute to various systems of the body and overall health. Only Naturals...
Get Quotations 
Only Natural 525857 Pure Inositol Powder 2 Oz $21.58
Only Naturals Pure Inositol Powder is an inositol supplement that is used to reinforce a diet. Inositol supplements may contribute to various systems of the body and overall health. Only Naturals...
Get Quotations 
NOW Foods Inositol Pure Powder, 4 Ounces 10.78
Size: 4 oz Inositol Powder Vegetarian by Now Foods 4 oz Powder Inositol Powder Vegetarian 4 oz Powder Product Inositol is a non-essential member of the B-Complex family with dietary sources fro...
Get Quotations 
Only Natural Pure Inositol Powder, 4 Ounce 21.45
Only Natural's Pure Inositol Powder is an inositol supplement that is used to reinforce a diet. Inositol supplements may contribute to various systems of the body and overall health. Only Natural's pu...
Get Quotations 
Only Natural Pure Inositol Powder - 2 oz 12.10
Only Natural s Pure Inositol Powder is an inositol supplement that is used to reinforce a diet. Inositol supplements may contribute to various systems of the body and overall health. Only Natural s pu...
Get Quotations 
INPP4B (Type II Inositol 3,4-bisphosphate 4-phosphatase, Inositol Polyphosphate 4-phosphatase Typ... 515.00
SynName: Anti -INPP4B (Type II Inositol 3,4-bisphosphate 4-phosphatase, Inositol Polyphosphate 4-phosphatase Type II); INPP4B (Type II Inositol 3,4-bisphosphate 4-phosphatase, Inositol Polyphosphate 4...
Get Quotations ![Wholesale Only Natural Pure Inositol Powder - 4 oz, [Health Supplements, Vitamins]](http://guideimg.alibaba.com/images/shop/2015/08/11/29/wholesale-only-natural-pure-inositol-powder-4-oz-health-supplements-vitamins_7427329.jpeg)
Wholesale Only Natural Pure Inositol Powder - 4 oz, [Health Supplements, Vitamins] 27.93
Wholesale price - Only Natural's Pure Inositol Powder is an inositol supplement that is used to reinforce a diet. Inositol supplements may contribute to various systems of the body and overall health....
Get Quotations ![Wholesale Only Natural Pure Inositol Powder - 2 oz, [Health Supplements, Vitamins]](http://guideimg.alibaba.com/images/shop/2015/07/30/3/wholesale-only-natural-pure-inositol-powder-2-oz-health-supplements-vitamins_6834403.jpeg)
Wholesale Only Natural Pure Inositol Powder - 2 oz, [Health Supplements, Vitamins] 13.34
Wholesale price - Only Natural's Pure Inositol Powder is an inositol supplement that is used to reinforce a diet. Inositol supplements may contribute to various systems of the body and overall health....
Get Quotations 
INPP1 (Inositol Polyphosphate 1-phosphatase, IPP, IPPase, MGC110984) (Antibody) 550.00
*Seq: MSDILRELLCVSEKAANIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVIKQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVHQDVAFTDPTLDSTEINVPQDILGIWVDPIDSTYQYIKGSADIKSNQGIFPCGLQCVTILIGVYDIQTG...
Get Quotations 
Inositol - 400 Grams (14.11 Oz) - 99+% Pure - FBLM 32.88
Inositol is a naturally occurring nutrient and plays an important role in cell signalling and cellular membranes. Once considered part of the B Vitamin family, inositol is used as an ingredient in die...
Get Quotations 
Inositol - 400 Grams (14.11 Oz) - 99+% Pure - FBA 35.88
Inositol is a naturally occurring nutrient and plays an important role in cell signalling and cellular membranes. Once considered part of the B Vitamin family, inositol is used as an ingredient in die...
Get Quotations 
Inositol from Rice 200 Tabs - Biotics 24.00
Inositol The tablets are now smaller for ease of swallowing. Each capsule of Inositol contains 325 mg of inositol derived from rice. The advantage of using rice is that rice does not contain gluten. M...
Get Quotations 
Enzymatic Therapy - Cell Forte With Ip-6 & Inositol, 60 wafers 24.70
IP-6 & Inositol Double-strength Chewable o Boasts natural killer-cell activity* o Delivers life-changing results!* o The leader since 1998 Serious Deep Immune Defense for Life-Changing Results* Ti...
Get Quotations 
Inositol 500mg 100 Capsules (Pack of 2) 15.23
Part of B-complex familyMyo-Inositol FormA Dietary SupplementInositol is a non-essential member of the B-Complex family with dietary sources from both animal and plant foods. The form of Inositol used...
Get Quotations 
Enzymatic Therapy Cell FortE with IP-6 and Inositol Tabs 23.99
Serious Deep Immune Defense for Life-Changing ResultsTime is precious. So when enhancing your deep immune health is your top priority, take action toward triumphant results with Cell Forte IP-6 & ...
Get Quotations 
Choline and Inositol - Nature's Way - 100 Capsules - Pack of 2 27.95
Nature's Way Choline and Inositol 250 mg/250 mg - 100 Capsules Nature's Way Choline and Inositol is bound to tartaric acid to improve absorption. Nature's Way Choline and Inositol is an essential prec...
Get Quotations 
MINPP1, NT (MINPP1, MIPP, Multiple inositol polyphosphate phosphatase 1, 2,3-bisphosphoglycerate ... 500.00
SynName: Anti -MINPP1, NT (MINPP1, MIPP, Multiple inositol polyphosphate phosphatase 1, 2,3-bisphosphoglycerate 3-phosphatase, Inositol (1,3,4,5)-tetrakisphosphate 3-phosphatase); MINPP1, NT (MINPP1, ...
Get Quotations 
Inositol 1,4,5-trisphosphate 3-kinase A, CT (Inositol-trisphosphate 3-kinase A, InsP 3-kinase A, ... 500.00
SynName: Anti -Inositol 1,4,5-trisphosphate 3-kinase A, CT (Inositol-trisphosphate 3-kinase A, InsP 3-kinase A, IP3 3-kinase A, IP3K A, IP3KA, IP3-3KA, ITPKA); Inositol 1,4,5-trisphosphate 3-kinase A,...
Get Quotations 
ITPKC (Inositol-trisphosphate 3-kinase C, Inositol 1,4,5-trisphosphate 3-kinase C, IP3 3-kinase C... 490.00
SynName: Anti -ITPKC (Inositol-trisphosphate 3-kinase C, Inositol 1,4,5-trisphosphate 3-kinase C, IP3 3-kinase C, IP3K C, InsP 3-kinase C, IP3KC); ITPKC (Inositol-trisphosphate 3-kinase C, Inositol 1,...
Get Quotations 
SHIP, CT (INPP5D, SH2-containing Inositol 5-phosphatase 1, SH2 Domain-containing Inositol Phospha... 495.00
SynName: Anti -SHIP, CT (INPP5D, SH2-containing Inositol 5-phosphatase 1, SH2 Domain-containing Inositol Phosphatase 1, SHIP-1, Inositol Polyphosphate-5-phosphatase of 145kD, SIP-145, p150Ship Phospha...
Get Quotations 
Pure Encapsulations - Inositol (powder) 250 gram 38.30
Inositol is a component of the B-complex family. Myo-inositol is the primary form of inositol found in the central nervous system. It plays an important role in cell membrane formation and serves as p...
Get Quotations 
0:30 iherb inositol, www.iherb.com vitamin k2 
Freeda Inositol Powder - 16 OZ. 39.20
Inositol is a B Complex nutrient. Nutritionists recommend inositol to help people relax and also to help them fall asleep more easily. Inositol may help improve one's mood. Inositol may help the cells...
Get Quotations 
Healthy Origins 528257 Inositol Powder 600 Mg 8 Oz $39.97
Healthy Origins Inositol Powder Description: Proper functioning of nerves brain muscles liver problems depression panic attacks diabetes and eduction of blood cholesterol levels. Model...
Get Quotations 
Inositol 750 mg Kal 90 VCaps 9.61
Inositol 750 mg by Kal 90 VegCap Inositol 750 mg 90 VegCap Kal Inositol 750 mg is intended to provide nutritive support for normal heart eye liver and brain function. Inositol also provides nutritive ...
Get Quotations 
BulkSupplements Pure Inositol Hexaphosphate Powder (500 grams) 31.96
Inositol hexaphosphate is the main vehicle through which phosphorus is stored in plant tissues. Seeds and bran make the most use out of inositol hexaphosphate. It is sometimes called IP6, phytate, or ...
Get Quotations 
BulkSupplements Pure Inositol Hexaphosphate Powder (100 grams) 15.96
Inositol hexaphosphate is the main vehicle through which phosphorus is stored in plant tissues. Seeds and bran make the most use out of inositol hexaphosphate. It is sometimes called IP6, phytate, or ...
Get Quotations 
25 Grams Bridge City Bulk Pure Inositol Powder - Vitamin B8 6.95
Inositol - often referred to as Vitamin B8, although it is not technically a member of the B-vitamin family - is a naturally occurring sugar-like nutrient that helps the body produce energy and aids t...
Get Quotations 
INPP5B (OCRL2, Type II Inositol 1,4,5-trisphosphate 5-phosphatase, 75kD Inositol Polyphosphate-5-... 550.00
SynName: Anti -INPP5B (OCRL2, Type II Inositol 1,4,5-trisphosphate 5-phosphatase, 75kD Inositol Polyphosphate-5-phosphatase, Phosphoinositide 5-phosphatase, MGC65156, MGC71303); INPP5B (OCRL2, Type II...
Get Quotations 
Vitacost Inositol Powder -- 730 mg per serving - 8 oz (227 g) 19.51
What is inositol?Inositol is a substance found naturally in legumes, cereals, nuts, fruits, human (not cows) milk and animal tissue. Its considered non-essential because the body can synthesize it fro...
Get Quotations 
Enzymatic Therapy Cell Fort? With IP-6 and Inositol (powder) 14.6 oz ( Multi-Pack) 101.81
IP-6 & Inositol provides valuable health benefits by increasing levels of phosphates in your cells to help strengthen your immune system. While IP-6 is found in rice bran and other foods, there ar...
Get Quotations Show More Results
You may also be interested in:
pure inositol best inositol niacin inositol caffeine inositol pure inositol nf12 inositol yves rocher best inositol powder pure inositol powder factory inositol price best price myo inositol China inositol China myo inositol China choline inositol China inositol nf12 China inositol 99% China inositol food grade China food grade inositol China inositol raw China crystalline inositol China vitamin inositol
China Best Supplier Inositol Niacinate /cas:6556-11-2 - Buy High Quanlity Inositol Niacinate6556-11-2 Product on Alibaba.com US $1-1000 / Kilogram ( FOB Price)
Where to buy cheap inositol and? Welcome to AliSource ,Get Quotataions Now >>>